Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: RacC

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence A high-throughput reverse genetics approach (Toxin Inhibition by Conjugation, TIC) was used to identify RcaT inhibitor. The TIC (Toxin Inhibition by Conjugation) platform is a high-throughput genetic screen designed to identify blockers of toxin activity. It involves conjugating an E. coli overexpression library into a strain expressing the toxin gene (rcaT) under an inducible promoter. Strains that regain growth upon co-induction of the toxin and a library gene are considered to carry candidate RcaT inhibitors.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Salmonella enterica type II Retron (Sen2)
Relevant publication(s) DOI 10.1038/s41586-022-05091-4
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Metagenome
Defence system(s) inhibited by the protein Defences Retron

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MITNYEATVVTTDDIVHEVNLEGKRIGYVIKTENKETPFTVVDIDGPSGNVKTLDEGVKKMCLVHIGKNLPAEKKAEFLATLIAMKLKGEI