Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Rad

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) degrades msDNA and ncRNA of the retron.
Evidence Rad (ORF75 of SP15, named retron anti-defense or Rad) was pinpointed within an 8 kb Anti-Defense Island (ADI) whose deletion impaired phage infectivity against E. coli strains carrying retrons Ec67, Ec78, and Ec83. Cloning of this ORF restored infectivity, confirming Rad’s anti-retron function. Expression (ECO_0000017) of Rad in E. coli carrying retrons Ec67, Ec78, or Ec83 restored infectivity of otherwise sensitive phages (T5n or ΦSP15m). Single-point mutations in conserved residues (R13E, P33T, I88T, D135H, E156H) led to partial loss of Rad activity (ECO_0001113). Double mutations completely abolished anti-retron function (ECO_0001113). Co-expression of Rad with retron systems led to a marked decrease in the production of msDNA and its precursor ncRNA (msr-msd), but not RT or effector protein transcripts. This implies Rad degrades the ncRNA necessary for msDNA synthesis, directly interfering with retron function. Results on Rad are not included in the peer-review version of the paper.
MoA Category degrades or sequesters molecules utilised by host defence systems
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type 1A retron (Ec83)
Relevant publication(s) DOI 10.1101/2023.03.15.532788, 10.1038/s41467-024-53789-y
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Escherichia coli phage ΦSP15
Defence system(s) inhibited by the protein Defences Retron

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Toprim_2 PF13155 88 2 66 105 166 104 181 2.8e-07

Sequence Viewer

Amino acid position: -

MLNSLYNISINLKEEPNMNVDELTQHLLSRGFDTDKYHCWLSPEGWLTVPLYDFSGMLRGYQTYNPSAPKGHGKCPFEAKYFTYSTTQCVWGLETLNGDEKVVLIAESVFKAVALHNAGYPALAMLGSSPGKALLKQLKLLPFKLVAVGDNDPAGEKFARKLNGFVSPVDVDEMSTENLKNFLAMKLNF