Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Ral

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) Enables bacteriophage λ to utilize the host EcoK methyltransferase to methylate its own genome, thereby enhancing modification and alleviating restriction. Ral likely interacts with the HsdM or HsdS subunits of the EcoK complex, altering their conformation to increase methylation efficiency.
Evidence Ectopic expression evidence (ECO_0000017)
MoA Category uncategorised
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type I RM
Relevant publication(s) DOI 10.1016/0022-2836(86)90071-9
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Phage λreverse
Defence system(s) inhibited by the protein Defences RM

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Ral PF11058 66 1 66 1 66 1 66 1.8e-50

Sequence Viewer

Amino acid position: -

MTTTIDKNQWCGQFKRCNGCKLQSECMVKPEEMFPVMEDGKYVDKWAIRTTAMIARELGKQNNKAA