Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: RIIB

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) Triggers Gasdermin defence
Evidence The experimental evidence supporting RIIB activity includes: (1) RIIB translation mutants with reduced protein levels showed graded susceptibility to rex-mediated restriction, correlating with the amount of RIIB produced. For example: (a) rII mutants expressing 46% and 39% of wild-type RIIB had partial restriction. (b) Mutants expressing 7%, 3%, or 0% (deletion mutant r638, ECO_0001038) were fully restricted. (2) The restriction level correlated quantitatively with RIIB levels and rex expression levels (modulated via IPTG induction or promoter strength). (3) Complementation data showed that wild-type RIIB activity is required to overcome rex restriction, and that loss of RIIB leads to arrest of phage development in rex⁺ hosts. (4) Temperature-dependent effects further confirmed RIIB’s role: restriction by rex was stronger at 42°C and weaker at 30°C, matching expected temperature sensitivity of translation or protein stability.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli RexAB
Relevant publication(s) DOI 10.1128/jvi.61.12.3790-3794.1987
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Enterobacteria phage T4
Defence system(s) inhibited by the protein Defences RexAB

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MYNIKCLTKNEQAEIVKLYSSGNYTQQELADWQGVSVDTIRRVLKNAEEAKRPKVTISGDITVKVNSDAVIAPVAKSDIIWNASKKFISITVDGVTYNATPNTHSNFQEILNLLVADKLEEAAQKINVRRAVEKYISGDVRIEGGSLFYQNIELRSGLVDRILDSMEKGENFEFYFPFLENLLENPSQKAVSRLFDFLVANDIEITEDGYFYAWKVVRSNYFDCHSNTFDNSPGKVVKMPRTRVNDDDTQTCSRGLHVCSKSYIRHFGSSTSRVVKVKVHPRDVVSIPIDYNDAKMRTCQYEVVEDVTEQFK