Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: S-adenosyl-methionine_lyase

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) degrades S-adenosyl-methionine (SAM) and inhibits SAM synthase. SAM is believed to be a co-factor in BREX-mediated and RM-mediated exclusion.
Evidence Deletion mutants lacking gene 0.3 encoding S-adenosyl-methionine lyase failed to overcome host restriction and exhibited no detectable SAMase activity in infected E. coli cells (ECO_0001038). Assays of cell extracts infected with various T3 strains showed that wild-type T3 induced strong SAMase activity, while T3 mutants such as R1, R4, R7, R12, and R13 showed both restriction sensitivity and complete loss of SAMase function. An amber mutant (HR2) produced SAMase only in suppressor hosts, confirming gene-linked inactivation. However, strain 3356 retained the ability to overcome restriction despite loss of SAMase activity, indicating that SAMase production is not the sole mechanism for bypassing restriction systems. Electrophoresis of phage-infected protein samples revealed the absence of the 0.3 protein in deletion and amber mutants, directly linking gene 0.3 to SAMase function. The enzyme cleaved radiolabeled S-adenosylmethionine in vitro, forming detectable products by thin-layer chromatography (ECO_0000325), establishing enzymatic activity of the SAMase gene product.
MoA Category degrades or sequesters molecules utilised by host defence systems
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type I RM;Escherichia coli type I BREX
Relevant publication(s) DOI 10.1128/JVI.19.1.136-145.1976, 10.1016/j.celrep.2023.112972
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 6ZNB
Genome(s) encoding the protein Protein Source Enterobacteria phage T3
Defence system(s) inhibited by the protein Defences RM, BREX

3D structure

PDB entry model.

A similar PDB structure exists: 6ZNB

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
S-AdoMet_lyase PF23780 133 1 132 13 151 13 152 6.2e-44

Sequence Viewer

Amino acid position: -

MIFTKEPAHVFYVLVSAFRSNLCDEVNMSRHRHMVSTLRAAPGLYGSVESTDLTGCYREAISSAPTEEKTVRVRCKDKAQALNVARLACNEWEQDCVLVYKSQTHTAGLVYAKGIDGYKAERLPGSFQEVPKGAPLQGCFTIDEFGRRWQVQ