Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Sequestin

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) bind and sequester the TIR-produced signaling molecules 3′cADPR and His-ADPR
Evidence Sequestin proteins were identified as anti-Thoeris defense factors through infection assays where co-expression of Sequestin with the type I Thoeris system in Bacillus subtilis restored phage SBSphiJ infectivity, leading to culture collapse and plaque formation. When Sequestin genes were engineered into the SBSphiJ phage genome, infectivity was similarly restored in Thoeris-expressing cells, confirming functional inactivation. NADase assays showed that lysates from Sequestin-expressing infected cells failed to activate ThsA, indicating depletion of the 3′cADPR immune signal. Biochemical binding was demonstrated by size-exclusion chromatography (ECO_0000325) and HPLC (ECO_0001272), where Sequestin bound and removed 3′cADPR from solution, with chloroform denaturation releasing the intact molecule. AlphaFold3 modeling placed 3′cADPR in conserved inter-protomer binding pockets, and alanine substitutions in key residues (E12, Q47, R61) abolished anti-defense function, confirming their role in sequestration (ECO_0006341).
MoA Category degrades or sequesters molecules utilised by host defence systems
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Bacillus cereus MSX-D12 type I Thoeris
Relevant publication(s) DOI 10.1101/2025.07.12.664507
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Metagenomics data (IMG_VR ID: IMGVR_UViG_3300045988_056527)
Defence system(s) inhibited by the protein Defences Thoeris

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
crAss001_48 PF21825 63 2 61 5 62 4 64 4.1e-17

Sequence Viewer

Amino acid position: -

MEKSVFDRLLTEYKELETKTTKLRDFLINKIDKTSIDNLNKDLLIAQLKAMEAYLTILSIRIGLNQPTQEEKQLDEAKALAKSTINE