Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Surt

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Ectopic co-expression (ECO_0000017) of Surt with AbiU in the superhost restored phage infectivity to levels similar to GFP-expressing controls, indicating complete inhibition of AbiU defense.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Vibrio cyclitrophicus superhost with AbiU
Relevant publication(s) DOI 10.1101/2024.06.14.598830
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Vibrio phage 1.217.O.
Defence system(s) inhibited by the protein Defences AbiU

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Phage_Mu_Gp48 PF10076 150 3 150 12 192 10 192 2e-35

Sequence Viewer

Amino acid position: -

MGHSVEQWTNSIMAQMPRGILWQRSASLDLYKYAAGYAPRLEAVEVSADSLLLEMRPENTQQLLDEWEEYLGLPECQVQNQTFESRRAAVVEKYHRKGGLQAWNIDKLGADLGFEIEVEEIFPHHCLRGCTYPLYEEKYRHLLRIHVRGITQAYATCLDDCLTPLVSQTAAILECTLNQFKLGGKYYEFIYEESV