Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: T7 protein kinase

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) hyperphosphorylates E. coli early proteins, with a preference for DNA/RNA-binding proteins including DNA-targeting defence systems.
Evidence T7 protein kinase (T7K) was identified as a broad-spectrum anti-defense factor through infection assays comparing wild-type T7 and a Δ0.7 mutant lacking the kinase. Deletion of T7K reduced infectivity in E. coli strains expressing DNA-targeting defense systems such as Retron-Eco9 and DarTG1 (ECO_0001175). Mass spectrometry (ECO_0001096) during infection revealed extensive phosphorylation of host and phage proteins, with Retron-Eco9's RcaT toxin and DarTG1’s DarT toxin among the stoichiometrically modified targets. Phosphomimetic mutations at key T7K-targeted sites (e.g., RcaT S155D, S254D; DarT T103D) abolished defense activity, confirming functional inactivation via phosphorylation. T7K’s C-terminal domain was shown to bind DNA, directing its otherwise promiscuous kinase activity to nucleic acid-binding defense components.
MoA Category adds a post-translational modification and deactivates bacterial defence
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type II Retron (Eco9) and type IV TA system DarTG
Relevant publication(s) DOI 10.1101/2024.12.20.629319
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Enterobacteria phage T4
Defence system(s) inhibited by the protein Defences Retron, TA
View homologs from eukaryotic dsDNA viruses

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MNITDIMNAIDAIKALPICELDKRQGMLIDLLVEMVNSETCDGELTELNQALEHQDWWTTLKCLTADAGFKMLGNGHFSAAYSHPLLPNRVIKVGFKKEDSGAAYTAFCRMYQGRPGIPNVYDVQRHAGCYTVVLDALKDCERFNNDAHYKYAEIASDIIDCNSDEHDELTGWDGEFVETCKLIRKFFEGIASFDMHSGNIMFSNGDVPYITDPVSFSQKKDGGAFSIDPEELIKEVEEVARQKEIDRAKARKERHEGRLEARRFKRRNRKARKAHKAKRERMLAAWRWAERQERRNHEVAVDVLGRTNNAMLWVNMFSGDFKALEERIALHWRNADRMAIANGLTLNIDKQLDAMLMG