Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Tad1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds the signalling molecule (1′′–3′ gcADPR)
Evidence Gene was identified based on differential sensitivity to the Thoeris defence systems — among closely related phages infecting Bacillus subtilis, all phages were sensitive to the Thoeris defence systems, apart from SBSphiJ7. Ectopic expression (ECO_0000017) of Tad1 into B. subtilis cells that also express the Thoeris system from Bacillus cereus MSX-D12 rendered phages usually sensitive to Thoeris resistant to the defence system. Silencing of tad1 in the phage SBSphiJ7 using dCas9 restored Thoeris defense, proving that Tad1 is necessary for immune evasion. To detect signalling molecules, lysates from Thoeris-expressing cells infected with phage lacking Tad1 and triggered ThsA NADase activity, but co-expression with Tad1 abolished this activity, indicating that Tad1 interferes upstream of ThsA activation. Adding purified Tad1 to signalling-containing lysates eliminated the ThsA activation signal, indicating Tad1 directly binds and sequesters the signalling molecule. Tad1 was crystallised (ECO_0001823) in complex with the signalling molecule (1′′–2′ gcADPR).
MoA Category degrades or sequesters molecules utilised by host defence systems
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Bacillus subtilis BEST7003 type I Thoeris;Pseudomonas aeruginosa type II-A and type III-C CBASS
Relevant publication(s) DOI 10.1038/s41586-022-05375-9
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 7UAV_A
Genome(s) encoding the protein Protein Source Bacillus phage SBSphiJ7
Defence system(s) inhibited by the protein Defences Thoeris, CBASS

3D structure

PDB entry model.

A similar PDB structure exists: 7UAV_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Acb2_Tad1_hairpin PF24729 58 24 54 91 126 82 130 3.2e-10

Sequence Viewer

Amino acid position: -

MRELKHELLPTRHTQVFHEDKDKMEFNAPHHFVVVPAGSPLVDQQIHYGRGGNSKKVTVKDFAGKLATVNFQLGPVTEHGANGVMNEDLIAMVITRLQYFQNSEFNCRENAMAITKLEEALMWLNKRTAEREQRGVEGTHEK