Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Tad2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) sequesters gcADPR
Evidence Comparative genomics of closely related phages with differential sensitivity to the Thoeris defence system identified Tad2 as a factor conferring resistance. Deletion of tad2 rendered phages sensitive to Thoeris defence (ECO_0001038) and inserting tad2 into a sensitive phage conferred resistance.. Ectopic expression of tad2 (ECO_0000017) blocked Thoeris-mediated defence in bacterial cells. Biochemical evidence supports that Tad2 binds 1″–3′ gcADPR (KD ≈ 23.3 nM), preventing activation of the NADase effector ThsA. Crystal structure further supports sponge function (ECO_0005671).
MoA Category degrades or sequesters molecules utilised by host defence systems
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Bacillus subtilis type I Thoeris
Relevant publication(s) DOI 10.1038/s41586-023-06869-w
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 8SME
Genome(s) encoding the protein Protein Source Bacillus phage SPO1
Defence system(s) inhibited by the protein Defences Thoeris

3D structure

PDB entry model.

A similar PDB structure exists: 8SME

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Tad2-like PF11195 73 1 73 6 89 6 89 3.3e-26

Sequence Viewer

Amino acid position: -

SMKTKMSFGEALEVLKQGMQVYRSGWNGKNMFLFLKSSDALASDFGFGFGEYINEPVFGNIIFIKTADNKIHAWVPSQTDVLAEDWDIVS