Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Tad4

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the bacterial ThsB (Thoeris type I) and also inhibits plant (Brachypodium distachyon, BdTIR) and human (Sterile alpha and TIR motif containing 1, SARM1) TIR proteins involved in the innate immune response.
Evidence Ectopic expression (ECO_0000017) of tad4 in Bacillus cereus inhibits Thoeris-mediated antiphage defense in a plaque formation assay. Binding is supported by co-purification in pull-down assays (co-purification evidence, ECO_0006074).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Bacillus cereus MSX-D12 type I Thoeris
Relevant publication(s) DOI 10.1016/j.cell.2024.12.035
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Ga0307375_1001427612 (IMG/VR)
Defence system(s) inhibited by the protein Defences Thoeris

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MRLKDAEGWQKSREANQDPYGKAGLDYAERWAEMMEQWIPEDSTEKFITQQIENVAERCSHVADTEGITGFMYGCAVGLLSQVWEHGDALRRWHNLDCQIGTEGEEANESGKILNPAILDIK