Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Tad6

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to ThsB (Thoeris type I)
Evidence Ectopic expression (ECO_0000017) of tad6 in Bacillus cereus inhibits Thoeris-mediated antiphage defense in a plaque formation assay. Binding is supported by co-purification in pull-down assays (co-purification evidence, ECO_0006074).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Bacillus cereus MSX-D12 type I Thoeris
Relevant publication(s) DOI 10.1016/j.cell.2024.12.035
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Ga0105013_100020934 (IMG/VR)
Defence system(s) inhibited by the protein Defences Thoeris

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKMYVKAVLSVRRYKAGYEVREELVAGNQFDMDDIKVKTAYTPDGHYIGDSKTAYRLCKKRGIKPEPIDSEHNVCSIGFCEKEQKWYGWSHRAIYGFGIGSTCKKGDCHYVPTSFEEIQVDCYAKEEDDCVANCTVALEPVNPDEPERVQRAIPDSEEGRCVCAQENCVFEVGRGEWVAKTLDDAKQMAVDFAKSVA