Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Tad7

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the bacterial type II Thoeris protein, ThsB
Evidence Ectopic expression (ECO_0000017) of tad7 in Bacillus amyloliquefaciens inhibits Thoeris-mediated antiphage defense in a plaque formation assay.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Bacillus amyloliquefaciens Y2 type II Thoeris
Relevant publication(s) DOI 10.1016/j.cell.2024.12.035
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Ga0114343_100093911 (IMG/VR)
Defence system(s) inhibited by the protein Defences Thoeris

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

METKEIVELMLKSSDHNPYTGMLSKKDNLIAAIDLAKLCKDFADNGQTDEAMGIPSEQWDEVIDELNNL