Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Tifa

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) may directly interact with the toxin, toxN. AlphaFold 3 predicts a direct interaction between ToxN (https://www.ncbi.nlm.nih.gov/protein/WP_012609144.1) and Tifa (ipTM = 0.72, pTM = 0.75).
Evidence TifA was identified as a phage-encoded inhibitor of the bacterial toxin ToxN through experimental evolution of T4 phage on E. coli expressing the toxIN toxin-antitoxin system. Segmental amplification of the dmd-tifA locus was repeatedly selected in independently evolved T4 populations, enhancing infectivity on toxIN-containing hosts. Cloning and overexpression of tifA alone (but not dmd) in E. coli restored T4 infection in toxIN-expressing cells, confirming tifA as the active anti-defense factor. Functional assays showed that co-expression of TifA neutralized ToxN toxicity, rescuing cell growth. Deletion of the tifA start codon abolished this rescue, while a codon-recoded tifA retained activity, indicating that TifA acts as a protein antitoxin. Co-immunoprecipitation (ECO_0000085) experiments demonstrated a physical interaction between TifA and ToxN in vivo. Finally, T4 clones with tifA deletions lost the ability to infect cells with chromosomally encoded toxIN, confirming the necessity of TifA for defense evasion. These findings establish TifA as a direct, proteinaceous anti-toxin that inhibits ToxN-mediated phage defense. Binding it supported by computational structure modeling evidence (ECO_0006368).
MoA Category binds and inhibits host defence system (putative)
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type III TA toxIN
Relevant publication(s) DOI 10.7554/eLife.79549
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Enterobacteria phage T4
Defence system(s) inhibited by the protein Defences TA

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
DUF7279 PF23945 53 2 52 18 68 17 69 2.5e-22

Sequence Viewer

Amino acid position: -

MHIVLFKPTPYNVRKNTQFKALIADTWELVLDIPAEESPPFGRVEFIKFAVRPTKRQIRQCKRYFRKIVKLEKQFVTCDYAEILK