Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: U56

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Ectopic expression of U56 rescues phage from Retron-Eco1 in plaque assays (ECO_0000017). Purified U56 binds ADPr with micromolar affinity as shown by isothermal titration calorimetry (ECO_0001825).
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type II Retron (Eco1)
Relevant publication(s) DOI 10.1016/j.molcel.2024.05.001
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Escherichia phage ukendt
Defence system(s) inhibited by the protein Defences Retron
View homologs from eukaryotic dsDNA viruses

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
NADAR PF08719 163 3 154 11 161 9 169 3.7e-37

Sequence Viewer

Amino acid position: -

MRITDEYVFFFSHKDVFSNWYIAPFTETEPGYNETFCCVEQYMMWRKALLFKDHAIAAAILDHSTIRDNERKQAYYKRMGRAVSGFNNDMWEENRERIVMRGLCLKYVQNPDLYADLHLYQYKTFVEASPYDKVYGIGMGMYEPGVLNPATWKGQNLLGKYHNKLIEILFQDKIPQRRYL