Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Ugi

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds specifically and reversibly to the host uracil-DNA glycosylase, preventing removal of uracil residues from PBS2 DNA by the host uracil-excision repair system.
Evidence Biochemical evidence of inhibition of UDG activity using a [³H]-poly(dU) substrate (ECO_0000184).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Bacillus subtilis uracil-DNA glycosylase
Relevant publication(s) DOI 10.1016/S0021-9258(19)70472-4
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Bacillus phage PBS2
Defence system(s) inhibited by the protein Defences DNA repair

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
UDI PF18880 82 1 82 1 82 1 82 1.2e-48

Sequence Viewer

Amino acid position: -

MTNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML