Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Vcrx090

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) None
Evidence Deletion of vcrx089-090 (ECO_0007379) led to a 25-fold decrease in conjugation efficiency to V. cholerae O395 (which has an active type I R-M system). The transfer defect was rescued by deleting the recipient’s hsdR gene, confirming it’s R-M-related. Complementation in recipient cells (not donors) restored transfer efficiency, supporting their function post-DNA entry.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Vibrio cholerae type I CRISPR-Cas
Relevant publication(s) DOI 10.1093/nar/gkaa518
Other components of the anti-defence system Multicomponent System vcrx089
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Plasmid pVCR94
Defence system(s) inhibited by the protein Defences RM

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKKNDCLCRRYTFKDALTSETFEVFIGYKLLREPSSSGPGQFTMVKLNRTVTDGKAENWSETKLEGPFEANGPDTIPMSYKDKESQYVSQFLSQGYTFLDEVLVNAETQTVLEGGSVSAGQTASLGSLNWLLSPPSELPPGDINLFKGFVAGVFAKGAGLIGFEVARSEGSNDLLPSVLMRTDSGYELGVSTGLGENTIHPATLEGAGELRPEHGHKPLLMLVYLQQRFADDFSNVEKPLVAFCDEQGDTFDYERFDSLKPLIERFGFSYDEVRADAERLGLVSELIRLAEIDAEQEDHFF