Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Vs.4

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds the signalling molecule cGAMP.
Evidence Deletion of vs.4 (ECO_0001038) in the T4 phage reduced its ability to infect bacteria lacking functional Cap2, indicating that Vs.4 helps evade CBASS immunity. Complementation with wild-type vs.4 restored phage infectivity, supporting its role as a CBASS antagonist. Isothermal titration calorimetry (ECO_0001825) revealed that Vs.4 binds cGAMP with high affinity (Kd ≈ 30 nM). Crystal structure (ECO_0001034) showed that Vs.4 forms a hexamer, each binding three cGAMP molecules. Mutations in Vs.4 that disrupt cGAMP binding or hexamerization (e.g., Y8A, F82A, A77I) abolishes CapV inhibition (ECO_0000015).
MoA Category degrades or sequesters molecules utilised by host defence systems
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type II CBASS
Relevant publication(s) DOI 10.1038/s41586-023-05862-7
Other components of the anti-defence system Multicomponent System -
Known structure in PDB PDB ID 7UQ2_A
Genome(s) encoding the protein Protein Source Enterobacteria phage T4
Defence system(s) inhibited by the protein Defences CBASS

3D structure

PDB entry model.

A similar PDB structure exists: 7UQ2_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Acb2_Tad1_hairpin PF24729 58 1 58 7 83 7 83 7.7e-22

Sequence Viewer

Amino acid position: -

MIEDIKGYKPHTEEKIGKVNAIKDAEVRLGLIFDALYDEFWEALDNCEDCEFAKNYAESLDQLTIAKTKLKEASMWACRAVFQPEEKY