Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Anti-TerI2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) prophage encoded anti-defence protein counteracting self-encoded defence system, TerI. TerI targets the terminase complex of invading phages, and anti-TerI1 and anti-Terl2 counteract Terl through direct interaction during prophage induction to allow virion production.
Evidence Anti-TerI2 (encoded by LMRG_02984) was independently identified as a second self-immunity protein opposing TerI activity. Its anti-defense function was initially obscured due to potential antisense transcriptional silencing of terI; however, co-expression experiments with a codon-modified synthetic terI (to eliminate antisense effects) confirmed that LMRG_02984 could restore virion production in TerI-expressing cells. Like Anti-TerI1, deletion of Anti-TerI2 (ECO_0001038) led to severely reduced virion production and DNA-less capsids, dependent on active terI. Bacterial adenylate cyclasebased two-hybrid assays demonstrated direct interaction between Anti-TerI2 and TerI, supporting a physical neutralization mechanism. Furthermore, overexpression of Anti-TerI2 restored phage infectivity during exogenous infection in TerI-expressing bacteria, underscoring its role as a functional anti-defense factor.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Prophage ϕ10403S TerI defence system (active in Listeria monocytogenes)
Relevant publication(s) DOI 10.1101/2025.02.27.640495
Other components of the anti-defence system Multicomponent System anti_rerI1
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Prophage ϕ10403S
Defence system(s) inhibited by the protein Defences TerI

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MIFTVNSFPQSGHEFTPGLTVNTCEHSGQVPSVPFLIISSLAIFRLCSLICLSNFFESNLILTPILPTSLHKNYSTVKGRTERRTKCQIYK