Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Dap1

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds and shields the Lon-protease target, phage HNH endonuclease.
Evidence Dap1 was previously characterized as a partial anti-defense factor that binds directly to the phage HNH endonuclease, shielding it from Lon-mediated degradation. In this study, a PaoP5Δdap1 mutant showed reduced plaque size and phage productivity (ECO_0001038). When combined with a dap2 deletion (PaoP5Δdap1Δdap2), the phenotype was exacerbated, producing tiny plaques and ~90% empty capsids as observed by electron microscopy. One-step growth assays confirmed a severe drop in burst size (~6.68% of wild-type), and in vitro degradation assays revealed that Dap1 alone only partially protected HNH from Lon degradation. However, full protection was restored only when Dap1 and Dap2 were co-expressed, confirming that Dap1 complements Dap2’s anti-defense activity through a distinct, synergistic mechanism of physical shielding of HNH, in contrast to Dap2’s inhibition of Lon itself.
MoA Category uncategorised
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa Lon-mediated antiviral defence
Relevant publication(s) DOI 10.1101/2025.03.13.642734, 10.1038/s41564-024-01719-5
Other components of the anti-defence system Multicomponent System dap2
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Pseudomonas phage PaoP5
Defence system(s) inhibited by the protein Defences Lon-mediated antiviral defence

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MKTKEIDVSNFTAEQFDAFLEYCQYAQLKVGEGVVDKIREWMEHPISVDGPDDSPRCLYIRDHPEDRFISYGTGLRSKWQPDMYALYRPTFQTKCVMTLGEADKYVIVGGKPLSLDELQATLAKQGVIVTFGRV