Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Dap2

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) directly binds to the Lon protease to prevent the degradation of the phage-encoded HNH endonuclease.
Evidence Dap2 was identified as an anti-defense factor through infection assays using a Δdap2 mutant of phage PaoP5. Deletion of dap2 (ECO_0001038) reduced phage burst size and resulted in smaller plaques in Pseudomonas aeruginosa PAO1, independent of the T3SS system, indicating an additional anti-defense function. Pull-down assays (ECO_0006249) and mass spectrometry identified Lon protease as a Dap2 binding partner (ECO_0001096).
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas aeruginosa Lon-mediated antiviral defence
Relevant publication(s) DOI 10.1101/2025.03.13.642734
Other components of the anti-defence system Multicomponent System dap1
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Pseudomonas phage PaoP5
Defence system(s) inhibited by the protein Defences Lon-mediated antiviral defence

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MYDKAQVLLWVGDNLLDYTRKSDGSPMTFLWYEEELKEAIGYSKSTYDFRRVDFHFVTEKKVTAYTLHECDTGPTTELNGTYTLQALKEIIAEMEEENEN