Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Polynucleotide_kinase

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) Adds a 5'-phosphate group to the 3'-OH end of the tRNA fragment cleaved by PrrC, making it ready for ligation.
Evidence Polynucleotide kinase (pnk) was shown to be essential for the repair of tRNAs cleaved by the T4-encoded anticodon nuclease. In T4-infected E. coli prr strains, specific tRNA fragments accumulated in infections with pnk mutants, while these fragments were transient during wild-type infection. This suggested that pnk activity was required to process and repair the cleavage products. Biochemical analysis of the cleavage termini revealed that pnk catalyzes conversion of 2':3'-cyclic phosphate and 5'-OH termini into 3'-OH and 5'-phosphate ends, creating substrates for RNA ligase. In vitro assays confirmed this, showing that only after incubation with purified pnk could the tRNA fragments be ligated by RNA ligase. Phosphatase digestion assays, thin-layer chromatography, and RNase T1 mapping of terminal groups provided direct evidence of enzymatic activity, specifically hydrolysis of 2':3'-cyclic phosphates and phosphorylation of 5'-OH ends, demonstrating the dual phosphatase and kinase roles of the pnk protein in tRNA repair.
MoA Category synthesises and restores essential molecules depleted by bacterial defence
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli PrrC
Relevant publication(s) DOI 10.1002/j.1460-2075.1987.tb02532.x
Other components of the anti-defence system Multicomponent System rna_ligase
Known structure in PDB PDB ID 1LY1
Genome(s) encoding the protein Protein Source Enterobacteria phage T4
Defence system(s) inhibited by the protein Defences PrrC
View homologs from eukaryotic dsDNA viruses

3D structure

PDB entry model.

A similar PDB structure exists: 1LY1

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
AAA_33 PF13671 143 2 141 5 148 4 150 5.4e-25
HAD_PNKP PF25109 143 1 143 159 301 159 301 3e-61

Sequence Viewer

Amino acid position: -

MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPKAVIFDVDGTLAKMNGRGPYDLEKCDTDVINPMVVELSKMYALMGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVECWQVASGDF