Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Vcrx092 (Bet)

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) involved in repairing double-strand DNA breaks via recombination between short sequence repeats (single-strand-annealing recombinase).
Evidence Deletion of any of these genes (vcrx091, vcrx092, and vcrx093) caused a 6–200 fold drop in conjugation efficiency in the presence of CRISPR targeting (ECO_0007379). Evasion was RecA-independent, consistent with single-strand annealing-type repair. The effect was rescued by complementation in the recipient only, showing the repair happens post-entry. Repaired plasmids showed specific deletions between short direct repeats, confirming Bet/Exo-mediated recombination.
MoA Category synthesises and restores essential molecules depleted by bacterial defence
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Vibrio cholerae type I CRISPR-Cas
Relevant publication(s) DOI 10.1093/nar/gkaa518
Other components of the anti-defence system Multicomponent System vcrx091; vcrx093
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Plasmid pVCR94
Defence system(s) inhibited by the protein Defences CRISPR-Cas

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
RecT PF03837 198 5 194 34 212 30 217 4.8e-30

Sequence Viewer

Amino acid position: -

MVSPNRSFVNWRNTMSDNKSLVTRIASRFGVDTRKFYETLKATAFKQRDGSAPTDEQMMTLLIVAEQYGLNPFTREIYAFPDKQNGIIPVVGVDGWSRIINEHPQYDGVEFVYSDKMVRMQGAKVECPEWIECVIYRKDRSRPIRIKEFIDEVYREPFQGQGRNGAYTVDGPWQTHTKRQLRHKSLIQCSRVAFGFSGIYDQDEAERIREMEQASAINPAIANLPSPSQVHSQEPLAIEHKELDPILTKLANRAIAEKAWSAAHEYVKGRYEGSELQYATQFLREKEMDQMEPPKPDYQESHEQESAAGGSANAELGAEEMPPLSDEDMIPVMEEEGAEGSYY