Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: ArdA

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds to the MTase of the type I RM complex and blocks it. Triggers Ronin defence.
Evidence Infection assays using bacteriophage λ demonstrated that ArdA inhibits restriction and modification by multiple E. coli type I systems (EcoA, EcoB, EcoD, EcoK, and EcoR124), with efficiency of plating (EOP) restored by factors of up to 10,000 (Table 1). ArdA also showed partial activity against the type II enzyme EcoRI, but not against type III (EcoPI) or McrA/McrBC systems, indicating specificity. Genetic evidence from Tn5 mutagenesis localized ArdA activity to a defined region of pKM101, where insertions abolished antirestriction function. A neighboring regulatory gene, ardR, was shown to suppress ArdA expression, while its disruption derepressed activity by 200-fold. Another locus, ardK, prevented ArdA-mediated lethality when cloned in trans, confirming ArdA's kil-type potential if unregulated.
MoA Category binds and inhibits host defence system
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type I RM
Relevant publication(s) DOI 10.1128/jb.174.15.5079-5085.1992
Other components of the anti-defence system Multicomponent System ardr; ardc; ardk
Known structure in PDB PDB ID 2W82_A
Genome(s) encoding the protein Protein Source Plasmid pKM101
Defence system(s) inhibited by the protein Defences RM

3D structure

PDB entry model.

A similar PDB structure exists: 2W82_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
ArdA PF07275 155 1 154 9 164 9 165 1.2e-32

Sequence Viewer

Amino acid position: -

MTDITTPSVYVGTYHKYNCGSIAGAWLDLTDFDSSEEFYERCRELHANEADPEFMFQDWEGIPSDMASECHINWDFINGFKQAREEGNEAAFVAFVDLFNSTDFDLFRDAYMGEAKDEETFAEEYLNDSGLLNEIPESVARYFDIVAYARDLFIGDFSLHDGHVFNMTC