Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: ArdC

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) ssDNA-binding protein with a metalloprotease domain; the mechanism is not clear.
Evidence ArdC was identified as an anti-restriction factor that enhances plasmid conjugation across species barriers by counteracting Type I restriction-modification systems. Deletion of ardC (ECO_0007379) from plasmid R388 drastically reduced conjugation efficiency from E. coli to Pseudomonas putida, but not within E. coli, implicating a specific defense mechanism in P. putida. This effect was rescued by expressing ArdC (ECO_0000017) in the recipient cell, but not in the donor, confirming recipient-side activity. Conjugation into P. putida ΔhsdRMS mutants restored high transfer rates even without ArdC, directly implicating the HsdRMS restriction system as the target. A catalytically inactive ArdC mutant (E229A) retained full antirestriction function in conjugation assays, indicating that metalloprotease activity is dispensable and suggesting that DNA binding is the functional mechanism. RNA-seq analyses during ArdC-mediated conjugation revealed SOS response activation in recipient P. putida, likely due to increased ssDNA exposure. Together, these data establish ArdC as a recipient-expressed, ssDNA-binding antirestriction protein that enables plasmid transfer by protecting incoming DNA from HsdRMS degradation.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Pseudomonas putida type I RM (hsdRMS)
Relevant publication(s) DOI 10.1371/journal.pgen.1008750
Other components of the anti-defence system Multicomponent System ardr; arda; ardk
Known structure in PDB PDB ID 6SNA_A
Genome(s) encoding the protein Protein Source Plasmid R388
Defence system(s) inhibited by the protein Defences RM

3D structure

PDB entry model.

A similar PDB structure exists: 6SNA_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
ArdcN PF08401 123 2 123 41 155 40 155 1.4e-44
MPTase-PolyVal PF18818 126 2 125 182 304 181 305 5.5e-49

Sequence Viewer

Amino acid position: -

MTMNLHTQTSVPNPAPATSASPLEQSGSSKTKFSKGKAKPDVYQVVTDSIIEALETGVKPWVCPWKRNGAVSGIPSNFTTGTSYSGINIMMLWYSAAAQGFTDSRWLTYKQAQELGAQVRKGEKGTTAIFYKMLEKETEAGEGEKIPMLKSFTVFNAEQIEGLTLEEKTAPQPVAEFDPLPQVEALFQRTGAKITERGQQAFFRPSTDEIWMPERHLFTDAANFYATGLHELVHWSGAKNRLNREKGGKFGSAGYAFEELIAELGSAFLMADLSIYGEVQHENYIASWLEALKGDKRFIFKAASAASKAHRYLMDF