Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: ArdR

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) the mechanism is not clear, apart from the role in regulating the expression of ardA and ardB.
Evidence ArdR was shown to repress expression of both ardA and ardB, particularly the downstream P1 promoters, through deletion mapping and promoter activity assays using CUP-region constructs. Promoter probe plasmids (e.g., pCAT66-6) showed significant chloramphenicol acetyltransferase (CAT) activity in the absence of ArdR, which was abolished upon its expression, indicating ArdR-dependent repression. Maxicell analysis confirmed expression of a ~20-kDa protein from ardR. The gene is located adjacent to ardB, and deletion of ardR led to derepression of ardB-mediated antirestriction activity. These results demonstrate that ArdR acts as a transcriptional repressor of both ard genes and can function synergistically with ArdK to silence both P1 and P2 promoters.
MoA Category unknown
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type I RM
Relevant publication(s) DOI 10.1128/jb.175.15.4843-4850.1993
Other components of the anti-defence system Multicomponent System arda; ardc; ardk
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Plasmid pKM101
Defence system(s) inhibited by the protein Defences RM

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MLATLQHPTAWQLPDRLMLLELLMFDYRNSDQERYGQQIYHHYRKQGNHRWDTSVHQDSGGQYAIIFRHSFSKKQADGVKRTMIRDETVIRAGTAQELTEATFPDFQDSDILKASDFFKSLIQRKAADVTQTDI