Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: DNA modifying beta-glucosyltransferase

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) Glucosylates hydroxymethyl-dCMP residues
Evidence Glucosylation activity is supported by structural determination evidence (ECO_0005031).
MoA Category modifies phage molecules to avoid recognition
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli RM
Relevant publication(s) DOI 10.1002/j.1460-2075.1994.tb06646.x
Other components of the anti-defence system Multicomponent System dnmp; dcmp_hm
Known structure in PDB PDB ID 2BGT_A
Genome(s) encoding the protein Protein Source Enterobacteria phage T4
Defence system(s) inhibited by the protein Defences RM
View homologs from eukaryotic dsDNA viruses

3D structure

PDB entry model.

A similar PDB structure exists: 2BGT_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
T4-Gluco-transf PF09198 167 1 167 1 166 1 166 1e-99

Sequence Viewer

Amino acid position: -

MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL