Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: Deoxynucleoside monophosphate kinase

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) synthesises hydroxymethyl-deoxycytidine triphosphate (Hm-dCTP) from Hm-dCMP.
Evidence Deoxynucleoside monophosphate kinase (DNK) was functionally validated as an active kinase through structural, biochemical, and comparative analyses. DNK was overexpressed, purified, and crystallized in both binary (DNK–dGMP) and ternary (DNK–dGMP–ATP) complexes, enabling direct observation of substrate binding (ECO_0001823). Crystallographic data revealed well-defined interactions between DNK and dGMP, including specific hydrogen bonds at the base, sugar, and phosphate groups, confirming nucleotide recognition. ATP binding was also structurally resolved, and although β- and γ-phosphates were disordered, modeling based on homologous structures indicated a catalytically competent P-loop conformation. The arrangement of active site residues and the requirement for domain closure to bring phosphates into proximity supported a mechanism of phosphoryl transfer. Furthermore, DNK specificity for dGMP, dTMP, and hmdCMP was supported by kinetic studies and structure-based rationalization of hydrogen bond patterns that exclude non-substrate nucleotides. Mutation data cited (e.g., His206Q inactivation) corroborated the functional importance of residues involved in catalysis. Involved in modification of 5-hydroxymethyl-dCMP.
MoA Category modifies phage molecules to avoid recognition
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli RM
Relevant publication(s) DOI PMID: 8670851 (there is no DOI)
Other components of the anti-defence system Multicomponent System dcmp_hm; bgt
Known structure in PDB PDB ID 1DEK_A
Genome(s) encoding the protein Protein Source Enterobacteria phage T4
Defence system(s) inhibited by the protein Defences RM
View homologs from eukaryotic dsDNA viruses

3D structure

PDB entry model.

A similar PDB structure exists: 1DEK_A

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
DNMK PF21448 232 1 232 2 233 2 233 3.3e-109

Sequence Viewer

Amino acid position: -

MKLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGPIKDALAYAWGVFAANTDYPCLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTRQDHEMDAARAMGATVIHVVRPGQKSNDTHITEAGLPIRDGDLVITNDGSLEELFSKIKNTLKVL