Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: DdrA

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) binds and protects phage DNA.
Evidence Genetic deletions (deletion mutation phenotypic evidence, ECO_0001038) result in high sensitivity to RM systems, while ectopic expression (ECO_0000017) restores plating efficiency.
MoA Category binds and protects the component targeted by the host defence
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Escherichia coli type I RM
Relevant publication(s) DOI 10.1016/0042-6822(87)90324-2, 10.1111/mmi.13705
Other components of the anti-defence system Multicomponent System dara; hdf; ddrb; darb; ulx
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Enterobacteria phage P1
Defence system(s) inhibited by the protein Defences RM

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

No Pfam domains found

Sequence Viewer

Amino acid position: -

MTLSAIELMDLSDKLDALMSKAATASGMELLDISDEIDQIMQQMGYGASGDGSGEEKQPSEHDGVPKLVADFLADKFVDQSTDAFIGTLQDLSQYVGIYIDLDQVKQHTAAWIAANIKEAA