Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: QueC

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) catalyses the ATP-dependent conversion of 7-cyano-7-deazaguanine (preQ0) into 7-carboxy-7-deazaguanine (CDG).
Evidence dG+ was significantly present only when both dpdA and gat-queC were expressed (ECO_0001096). Phages with modifications (e.g., dG+, dPreQ0, dPreQ1) showed varied resistance to various restriction enzymes.
MoA Category modifies phage molecules to avoid recognition
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Type II RM (in vitro)
Relevant publication(s) DOI 10.1038/s41467-019-13384-y
Other components of the anti-defence system Multicomponent System fole; qued; quee
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Enterobacteria phage 9g
Defence system(s) inhibited by the protein Defences RM
View homologs from eukaryotic dsDNA viruses

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
NAD_synthase PF02540 242 21 96 3 79 1 103 4.4e-10
QueC PF06508 210 1 209 2 217 2 218 4.3e-61

Sequence Viewer

Amino acid position: -

MKSVVLLSGGVDSATCLAIEVDKWGSKNVHAIAFNYGQKHEAELENAANVAMFYGVKFTILEIDSKIYSSSSSSLLQGKGEISHGKSYAEILAEKEVVDTYVPFRNGLMLSQAAAYAYSVGASYVVYGAHADDAAGGAYPDCTPEFYNSMSNAMEYGTGGKVTLVAPLLTLTKAQVVKWGIDLDVPYFLTRSCYESDAESCGTCATCIDRKKAFEENGMTDPIHYKEN