Bacterial virus anti-defence systems · sequence & structure resource

Encyclopaedia of Bacterial Virus Anti-Defence Systems


Protein: QueE

Download all data for this protein (.zip)

Overview

Mode of Action (MoA) catalyses the conversion of 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) into 7-cyano-7-deazaguanine (preQ0) (the third step of synthesis of 7-cyano-7-deazaguanine, a precursor in the pathway that leads to various DNA modifications found in phages).
Evidence Viral genes (e.g., folE, queD, queE from phage 9g) were expressed in corresponding E. coli deletion mutants (ΔfolE, ΔqueD, ΔqueE), restoration of queuosine (Q) modification in tRNA confirmed that these viral enzymes are functional analogs of their bacterial counterparts (ECO_0000017). Phages with modifications (e.g., dG+, dPreQ0, dPreQ1) showed varied resistance to various restriction enzymes.
MoA Category modifies phage molecules to avoid recognition
Subtype(s) of the defence system(s) inhibited by the protein Defence Subtype Type II RM (in vitro)
Relevant publication(s) DOI 10.1038/s41467-019-13384-y
Other components of the anti-defence system Multicomponent System quec; fole; qued
Known structure in PDB PDB ID -
Genome(s) encoding the protein Protein Source Enterobacteria phage 9g
Defence system(s) inhibited by the protein Defences RM

3D structure

AlphaFold 3 model.

Download structure file

Feature viewer - predicted secondary structure

Download features JSON file

Pfam annotations

Pfam Name Pfam Acc Pfam Length Colour HMM Start HMM End Ali Start Ali End Env Start Env End Evalue
Fer4_12 PF13353 137 1 100 33 142 33 151 3.4e-09
Radical_SAM PF04055 166 2 99 47 145 46 150 4.1e-10

Sequence Viewer

Amino acid position: -

MVNQYNQPERGKIRINVRDPEKMPIMEIFGPTIQGEGMVIGQKTIFIRTGGCDYHCNWCDSAFTWNGTTEPEYITGKEAASRILKLAFNDKGEQICNHVTLTGGNPALINEPMAKMISILKEHGFKFGLETQGTRFQEWFKEVSDITISPKPPSSGMRTNMKILEAIVDRMNDENLDWSFKIVIFDENDLAYARDMFKTFEGKLRPVNYLSVGNANAYEEGKISDRLLEKLGWLWDKVYEDPAFNNVRPLPQLHTLVYDNKRGV